Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 98219..98548 | Replicon | plasmid 2 |
| Accession | NZ_LR890537 | ||
| Organism | Escherichia coli isolate MSB1_8B-sc-2280300 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | JMX06_RS25990 | Protein ID | WP_001312861.1 |
| Coordinates | 98219..98377 (-) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 98421..98548 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX06_RS25965 | 93727..94548 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| JMX06_RS25970 | 94667..94954 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| JMX06_RS25975 | 94979..95185 | - | 207 | WP_000275859.1 | hypothetical protein | - |
| JMX06_RS25980 | 95098..95433 | - | 336 | WP_013023876.1 | hypothetical protein | - |
| JMX06_RS25985 | 96157..97824 | + | 1668 | WP_001091724.1 | group II intron reverse transcriptase/maturase | - |
| JMX06_RS25990 | 98219..98377 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 98421..98548 | - | 128 | NuclAT_0 | - | Antitoxin |
| - | 98421..98548 | - | 128 | NuclAT_0 | - | Antitoxin |
| - | 98421..98548 | - | 128 | NuclAT_0 | - | Antitoxin |
| - | 98421..98548 | - | 128 | NuclAT_0 | - | Antitoxin |
| - | 99990..100092 | - | 103 | NuclAT_1 | - | - |
| - | 99990..100092 | - | 103 | NuclAT_1 | - | - |
| - | 99990..100092 | - | 103 | NuclAT_1 | - | - |
| - | 99990..100092 | - | 103 | NuclAT_1 | - | - |
| JMX06_RS26000 | 100104..100823 | - | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
| JMX06_RS26005 | 100820..101254 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| JMX06_RS26010 | 101309..103267 | - | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | erm(B) / mph(A) / sul1 / qacE / aadA2 / dfrA12 / qepA4 / catA1 / tet(B) / sitABCD | iucA / iucB / iucC / iucD / iutA | 1..158162 | 158162 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T291327 WP_001312861.1 NZ_LR890537:c98377-98219 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
Antitoxin
Download Length: 128 bp
>AT291327 NZ_LR890537:c98548-98421 [Escherichia coli]
CGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTAA
GTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
CGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTAA
GTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|