Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 5032308..5032910 | Replicon | chromosome |
Accession | NZ_LR890536 | ||
Organism | Escherichia coli isolate MSB1_8B-sc-2280300 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | JMX06_RS24350 | Protein ID | WP_000897305.1 |
Coordinates | 5032599..5032910 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | JMX06_RS24345 | Protein ID | WP_000356397.1 |
Coordinates | 5032308..5032598 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX06_RS24325 | 5028810..5029712 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
JMX06_RS24330 | 5029709..5030344 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
JMX06_RS24335 | 5030341..5031270 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
JMX06_RS24340 | 5031485..5031703 | - | 219 | WP_001298592.1 | ribbon-helix-helix domain-containing protein | - |
JMX06_RS24345 | 5032308..5032598 | - | 291 | WP_000356397.1 | helix-turn-helix domain-containing protein | Antitoxin |
JMX06_RS24350 | 5032599..5032910 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
JMX06_RS24355 | 5033139..5034047 | + | 909 | WP_001318161.1 | alpha/beta hydrolase | - |
JMX06_RS24360 | 5034111..5035052 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
JMX06_RS24365 | 5035097..5035534 | - | 438 | WP_000560983.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
JMX06_RS24370 | 5035531..5036403 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
JMX06_RS24375 | 5036397..5036996 | - | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
JMX06_RS24380 | 5037095..5037880 | - | 786 | WP_000059679.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T291325 WP_000897305.1 NZ_LR890536:c5032910-5032599 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|