Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 4028374..4029068 | Replicon | chromosome |
| Accession | NZ_LR890536 | ||
| Organism | Escherichia coli isolate MSB1_8B-sc-2280300 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q0T7Q5 |
| Locus tag | JMX06_RS19415 | Protein ID | WP_001263491.1 |
| Coordinates | 4028374..4028772 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | L4JHF0 |
| Locus tag | JMX06_RS19420 | Protein ID | WP_000554755.1 |
| Coordinates | 4028775..4029068 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX06_RS19385 | 4023636..4025093 | + | 1458 | WP_022645227.1 | cytosol nonspecific dipeptidase | - |
| JMX06_RS19390 | 4025102..4025383 | + | 282 | WP_022645226.1 | hypothetical protein | - |
| JMX06_RS19395 | 4025400..4025909 | - | 510 | WP_001361775.1 | hydrolase | - |
| JMX06_RS19400 | 4025971..4026585 | - | 615 | WP_022645225.1 | peptide chain release factor H | - |
| JMX06_RS19405 | 4026582..4027721 | - | 1140 | WP_022645224.1 | RNA ligase RtcB family protein | - |
| JMX06_RS19410 | 4027912..4028364 | - | 453 | WP_023909048.1 | GNAT family N-acetyltransferase | - |
| JMX06_RS19415 | 4028374..4028772 | - | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| JMX06_RS19420 | 4028775..4029068 | - | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| JMX06_RS19425 | 4029120..4030175 | - | 1056 | WP_022645222.1 | DNA polymerase IV | - |
| JMX06_RS19430 | 4030246..4031031 | - | 786 | WP_072224360.1 | putative lateral flagellar export/assembly protein LafU | - |
| JMX06_RS19435 | 4031003..4032715 | + | 1713 | Protein_3810 | flagellar biosynthesis protein FlhA | - |
| JMX06_RS19440 | 4032813..4033586 | - | 774 | WP_022645219.1 | C40 family peptidase | - |
| JMX06_RS19445 | 4033772..4034032 | + | 261 | WP_000729708.1 | type II toxin-antitoxin system antitoxin DinJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T291317 WP_001263491.1 NZ_LR890536:c4028772-4028374 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TPK7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829G9H5 |