Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 2281761..2282418 | Replicon | chromosome |
Accession | NZ_LR890524 | ||
Organism | Burkholderia cepacia isolate MINF_4A-sc-2280433 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | ISX57_RS27775 | Protein ID | WP_194132115.1 |
Coordinates | 2282086..2282418 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | ISX57_RS27770 | Protein ID | WP_194131647.1 |
Coordinates | 2281761..2282093 (-) | Length | 111 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ISX57_RS27745 | 2279971..2280186 | + | 216 | WP_194132114.1 | type I toxin-antitoxin system SymE family toxin | - |
ISX57_RS27750 | 2280186..2280506 | + | 321 | WP_006494466.1 | XRE family transcriptional regulator | - |
ISX57_RS27755 | 2280605..2280829 | + | 225 | WP_194131644.1 | hypothetical protein | - |
ISX57_RS27760 | 2280819..2281313 | + | 495 | WP_194131645.1 | DUF2384 domain-containing protein | - |
ISX57_RS27765 | 2281341..2281661 | + | 321 | WP_194131646.1 | helix-turn-helix domain-containing protein | - |
ISX57_RS27770 | 2281761..2282093 | - | 333 | WP_194131647.1 | helix-turn-helix domain-containing protein | Antitoxin |
ISX57_RS27775 | 2282086..2282418 | - | 333 | WP_194132115.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ISX57_RS27780 | 2282798..2283640 | - | 843 | WP_194131648.1 | peptidyl-prolyl cis-trans isomerase | - |
ISX57_RS27785 | 2284175..2284984 | - | 810 | WP_194131649.1 | glycosyltransferase family 25 protein | - |
ISX57_RS27790 | 2284978..2285292 | - | 315 | WP_006494471.1 | hypothetical protein | - |
ISX57_RS27795 | 2285639..2287213 | + | 1575 | WP_194131650.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12969.09 Da Isoelectric Point: 9.9906
>T291279 WP_194132115.1 NZ_LR890524:c2282418-2282086 [Burkholderia cepacia]
MKNWTILYYDERVKRDVFALPKGILASYLRLIETMEEHGADLRMPHSRAMGAGLFELRPRGREGIGRVFYCVQVRYELVI
LHSFVKKTQETPEDELRIARRRMKEVQSNG
MKNWTILYYDERVKRDVFALPKGILASYLRLIETMEEHGADLRMPHSRAMGAGLFELRPRGREGIGRVFYCVQVRYELVI
LHSFVKKTQETPEDELRIARRRMKEVQSNG
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|