Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 69559..69812 | Replicon | plasmid 5 |
Accession | NZ_LR890519 | ||
Organism | Klebsiella pneumoniae isolate INF281-sc-2280206 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | JMX78_RS29660 | Protein ID | WP_001312851.1 |
Coordinates | 69663..69812 (+) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 69559..69618 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX78_RS29625 | 65335..66195 | + | 861 | WP_000704523.1 | alpha/beta hydrolase | - |
JMX78_RS29630 | 66298..66858 | + | 561 | WP_000139321.1 | fertility inhibition protein FinO | - |
JMX78_RS29635 | 66987..67199 | + | 213 | WP_001309245.1 | ANR family transcriptional regulator | - |
JMX78_RS29640 | 67444..67905 | + | 462 | WP_001233838.1 | thermonuclease family protein | - |
JMX78_RS29645 | 67951..68160 | + | 210 | WP_001298565.1 | hemolysin expression modulator Hha | - |
JMX78_RS29650 | 68198..68788 | + | 591 | WP_033807967.1 | DUF2726 domain-containing protein | - |
JMX78_RS29655 | 68943..69416 | + | 474 | WP_016240489.1 | hypothetical protein | - |
- | 69559..69618 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 69559..69618 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 69559..69618 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 69559..69618 | - | 60 | NuclAT_1 | - | Antitoxin |
JMX78_RS29660 | 69663..69812 | + | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
JMX78_RS29665 | 70097..70345 | + | 249 | WP_000083839.1 | replication regulatory protein RepA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | erm(B) | - | 1..70656 | 70656 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T291270 WP_001312851.1 NZ_LR890519:69663-69812 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT291270 NZ_LR890519:c69618-69559 [Klebsiella pneumoniae]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|