Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 13618..14275 Replicon plasmid 3
Accession NZ_LR890517
Organism Klebsiella pneumoniae isolate INF281-sc-2280206

Toxin (Protein)


Gene name higB Uniprot ID U3PDC3
Locus tag JMX78_RS27995 Protein ID WP_000270043.1
Coordinates 13925..14275 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag JMX78_RS27990 Protein ID WP_000124640.1
Coordinates 13618..13920 (-) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX78_RS27945 9243..9671 + 429 WP_000591074.1 hypothetical protein -
JMX78_RS27950 9728..10087 + 360 WP_000422768.1 hypothetical protein -
JMX78_RS27955 10087..10533 + 447 WP_000919345.1 Fe3+-siderophore ABC transporter permease -
JMX78_RS27960 10530..11048 + 519 WP_000210756.1 nitrite reductase -
JMX78_RS27965 11048..11278 + 231 WP_000972663.1 hypothetical protein -
JMX78_RS27970 11265..12122 + 858 WP_001167032.1 hypothetical protein -
JMX78_RS27975 12353..12880 + 528 WP_001236377.1 thermonuclease family protein -
JMX78_RS27980 12938..13210 + 273 WP_001043047.1 HU family DNA-binding protein -
JMX78_RS27985 13298..13591 + 294 WP_001239997.1 chromosome segregation protein ParM -
JMX78_RS27990 13618..13920 - 303 WP_000124640.1 XRE family transcriptional regulator Antitoxin
JMX78_RS27995 13925..14275 - 351 WP_000270043.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
JMX78_RS28000 14438..14986 + 549 WP_001061574.1 transcriptional regulator -
JMX78_RS28005 15327..15521 + 195 WP_000343597.1 hypothetical protein -
JMX78_RS28010 15532..15903 + 372 WP_000516916.1 hypothetical protein -
JMX78_RS28015 15896..16366 + 471 WP_001281821.1 hypothetical protein -
JMX78_RS28020 16381..16716 - 336 WP_000683476.1 hypothetical protein -
JMX78_RS28025 16813..17301 + 489 WP_001273096.1 DUF1643 domain-containing protein -
JMX78_RS28030 17304..17801 + 498 WP_000062185.1 hypothetical protein -
JMX78_RS28035 18016..18720 - 705 WP_001067855.1 IS6-like element IS26 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid dfrA23 / blaVEB-1 / ant(2'')-Ia / ARR-3 / cmlA1 / blaOXA-10 / ant(3'')-Ia / qacE / floR / tet(G) / rmtB / blaTEM-1B / blaCTX-M-15 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 - 1..128238 128238


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(33-79)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13328.21 Da        Isoelectric Point: 5.2421

>T291265 WP_000270043.1 NZ_LR890517:c14275-13925 [Klebsiella pneumoniae]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Download         Length: 351 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11006.73 Da        Isoelectric Point: 7.2036

>AT291265 WP_000124640.1 NZ_LR890517:c13920-13618 [Klebsiella pneumoniae]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7G8AFB9

Antitoxin

Source ID Structure

References