291258

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 3287492..3288078 Replicon chromosome
Accession NZ_LR890515
Organism Klebsiella pneumoniae isolate INF281-sc-2280206

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag JMX78_RS16485 Protein ID WP_002920800.1
Coordinates 3287492..3287860 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag JMX78_RS16490 Protein ID WP_004174006.1
Coordinates 3287857..3288078 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX78_RS16465 3282995..3284065 - 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
JMX78_RS16470 3284067..3284912 - 846 WP_004174009.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
JMX78_RS16475 3284909..3285796 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
JMX78_RS16480 3285903..3287219 - 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
JMX78_RS16485 3287492..3287860 - 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JMX78_RS16490 3287857..3288078 - 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMX78_RS16495 3288242..3288955 - 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
JMX78_RS16500 3288957..3289724 - 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
JMX78_RS16505 3289721..3290998 - 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
JMX78_RS16510 3290995..3291921 - 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 3282258..3304545 22287


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T291258 WP_002920800.1 NZ_LR890515:c3287860-3287492 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT291258 WP_004174006.1 NZ_LR890515:c3288078-3287857 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References