Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 29147..29401 | Replicon | plasmid 2 |
| Accession | NZ_LR890509 | ||
| Organism | Escherichia coli isolate MSB1_9I-sc-2280417 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | - |
| Locus tag | JMW57_RS23085 | Protein ID | WP_032355860.1 |
| Coordinates | 29147..29353 (-) | Length | 69 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 29340..29401 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW57_RS23060 | 25050..25976 | - | 927 | WP_097731803.1 | tricarballylate utilization LysR family transcriptional regulator TcuR | - |
| JMW57_RS23065 | 26973..27830 | - | 858 | WP_097731804.1 | incFII family plasmid replication initiator RepA | - |
| JMW57_RS23070 | 27823..28305 | - | 483 | WP_172949056.1 | hypothetical protein | - |
| JMW57_RS23075 | 28298..28372 | - | 75 | WP_001442103.1 | RepA leader peptide Tap | - |
| JMW57_RS23080 | 28606..28863 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| JMW57_RS23085 | 29147..29353 | - | 207 | WP_032355860.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 29340..29401 | + | 62 | NuclAT_1 | - | Antitoxin |
| - | 29340..29401 | + | 62 | NuclAT_1 | - | Antitoxin |
| - | 29340..29401 | + | 62 | NuclAT_1 | - | Antitoxin |
| - | 29340..29401 | + | 62 | NuclAT_1 | - | Antitoxin |
| JMW57_RS23090 | 29984..30196 | - | 213 | WP_089574766.1 | hypothetical protein | - |
| JMW57_RS23095 | 30329..30889 | - | 561 | WP_097731806.1 | fertility inhibition protein FinO | - |
| JMW57_RS23100 | 30944..31690 | - | 747 | WP_201524626.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..91228 | 91228 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 69 a.a. Molecular weight: 7856.40 Da Isoelectric Point: 8.8807
>T291238 WP_032355860.1 NZ_LR890509:c29353-29147 [Escherichia coli]
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCAMVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCAMVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 207 bp
Antitoxin
Download Length: 62 bp
>AT291238 NZ_LR890509:29340-29401 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|