Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 2019264..2019958 Replicon chromosome
Accession NZ_LR890508
Organism Escherichia coli isolate MSB1_9I-sc-2280417

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag JMW57_RS09895 Protein ID WP_001263493.1
Coordinates 2019264..2019662 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID -
Locus tag JMW57_RS09900 Protein ID WP_032162515.1
Coordinates 2019665..2019958 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW57_RS09865 2014264..2015508 - 1245 WP_000189541.1 esterase FrsA -
- 2014924..2015004 - 81 NuclAT_10 - -
- 2014924..2015004 - 81 NuclAT_10 - -
- 2014924..2015004 - 81 NuclAT_10 - -
- 2014924..2015004 - 81 NuclAT_10 - -
JMW57_RS09870 2015600..2016058 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
JMW57_RS09875 2016319..2017776 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
JMW57_RS09880 2017833..2018354 - 522 Protein_1936 peptide chain release factor H -
JMW57_RS09885 2018353..2018556 - 204 Protein_1937 RNA ligase RtcB family protein -
JMW57_RS09890 2018802..2019254 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
JMW57_RS09895 2019264..2019662 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
JMW57_RS09900 2019665..2019958 - 294 WP_032162515.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
JMW57_RS09905 2020010..2021065 - 1056 WP_032162516.1 DNA polymerase IV -
JMW57_RS09910 2021136..2021921 - 786 WP_000207587.1 putative lateral flagellar export/assembly protein LafU -
JMW57_RS09915 2021893..2023605 + 1713 Protein_1943 flagellar biosynthesis protein FlhA -
JMW57_RS09920 2023829..2024326 - 498 WP_000006255.1 REP-associated tyrosine transposase RayT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - gmhA/lpcA 1979448..2042931 63483


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T291228 WP_001263493.1 NZ_LR890508:c2019662-2019264 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11261.86 Da        Isoelectric Point: 5.9050

>AT291228 WP_032162515.1 NZ_LR890508:c2019958-2019665 [Escherichia coli]
MHRILAEKSVNITELRKNPVKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure

References