Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2156118..2156334 | Replicon | chromosome |
Accession | NC_020537 | ||
Organism | Staphylococcus aureus subsp. aureus ST228 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | SAI7S6_RS14895 | Protein ID | WP_001802298.1 |
Coordinates | 2156230..2156334 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2156118..2156173 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAI7S6_RS10825 | 2151677..2152054 | - | 378 | WP_000361059.1 | transposase | - |
SAI7S6_RS10830 | 2152061..2153953 | - | 1893 | WP_001557544.1 | site-specific integrase | - |
SAI7S6_RS10835 | 2153950..2155035 | - | 1086 | WP_000868132.1 | tyrosine-type recombinase/integrase | - |
SAI7S6_RS10840 | 2155153..2155797 | + | 645 | Protein_2044 | transcriptional regulator | - |
- | 2156118..2156173 | + | 56 | - | - | Antitoxin |
SAI7S6_RS14895 | 2156230..2156334 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
SAI7S6_RS16045 | 2156851..2157021 | + | 171 | WP_001792292.1 | transposase | - |
SAI7S6_RS15660 | 2157014..2157172 | + | 159 | WP_001792784.1 | hypothetical protein | - |
SAI7S6_RS10850 | 2157830..2158687 | - | 858 | WP_015445908.1 | Cof-type HAD-IIB family hydrolase | - |
SAI7S6_RS10855 | 2158755..2159537 | - | 783 | WP_000908182.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T29115 WP_001802298.1 NC_020537:c2156334-2156230 [Staphylococcus aureus subsp. aureus ST228]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T29115 NC_020537:c2156334-2156230 [Staphylococcus aureus subsp. aureus ST228]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT29115 NC_020537:2156118-2156173 [Staphylococcus aureus subsp. aureus ST228]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|