Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 3967920..3968517 | Replicon | chromosome |
Accession | NZ_LR890471 | ||
Organism | Klebsiella pneumoniae isolate INF168-sc-2280023 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A9J6S5A1 |
Locus tag | JMX14_RS19220 | Protein ID | WP_004893639.1 |
Coordinates | 3968200..3968517 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | R4YH91 |
Locus tag | JMX14_RS19215 | Protein ID | WP_004142561.1 |
Coordinates | 3967920..3968207 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX14_RS19185 | 3964000..3964248 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
JMX14_RS19190 | 3964266..3964607 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
JMX14_RS19195 | 3964638..3965753 | - | 1116 | WP_012737592.1 | MBL fold metallo-hydrolase | - |
JMX14_RS19200 | 3965933..3966514 | + | 582 | WP_004176968.1 | TetR/AcrR family transcriptional regulator | - |
JMX14_RS19205 | 3966514..3966882 | + | 369 | WP_004142557.1 | MmcQ/YjbR family DNA-binding protein | - |
JMX14_RS19210 | 3967002..3967655 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
JMX14_RS19215 | 3967920..3968207 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
JMX14_RS19220 | 3968200..3968517 | - | 318 | WP_004893639.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMX14_RS19225 | 3968702..3969745 | - | 1044 | WP_004893645.1 | DUF2157 domain-containing protein | - |
JMX14_RS19230 | 3970411..3971277 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
JMX14_RS19235 | 3971386..3972813 | + | 1428 | WP_004176980.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12100.35 Da Isoelectric Point: 11.2767
>T291130 WP_004893639.1 NZ_LR890471:c3968517-3968200 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPSIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPSIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|