Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 715227..716002 | Replicon | chromosome |
| Accession | NZ_LR890471 | ||
| Organism | Klebsiella pneumoniae isolate INF168-sc-2280023 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | B6ZBI6 |
| Locus tag | JMX14_RS03535 | Protein ID | WP_004889762.1 |
| Coordinates | 715517..716002 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | W8UEW1 |
| Locus tag | JMX14_RS03530 | Protein ID | WP_004150912.1 |
| Coordinates | 715227..715520 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX14_RS03510 | 710436..711038 | - | 603 | WP_004174410.1 | short chain dehydrogenase | - |
| JMX14_RS03515 | 711136..712047 | + | 912 | WP_201519914.1 | LysR family transcriptional regulator | - |
| JMX14_RS03520 | 712048..713196 | - | 1149 | WP_004889759.1 | PLP-dependent aspartate aminotransferase family protein | - |
| JMX14_RS03525 | 713207..714583 | - | 1377 | WP_201519915.1 | cystathionine beta-synthase | - |
| JMX14_RS03530 | 715227..715520 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
| JMX14_RS03535 | 715517..716002 | + | 486 | WP_004889762.1 | GNAT family N-acetyltransferase | Toxin |
| JMX14_RS03540 | 716706..717298 | + | 593 | Protein_696 | hypothetical protein | - |
| JMX14_RS03545 | 717395..717611 | + | 217 | Protein_697 | transposase | - |
| JMX14_RS03550 | 718248..719090 | + | 843 | WP_134912316.1 | hypothetical protein | - |
| JMX14_RS03555 | 719266..719484 | + | 219 | WP_134912317.1 | AlpA family transcriptional regulator | - |
| JMX14_RS03560 | 719624..719941 | + | 318 | WP_061351357.1 | hypothetical protein | - |
| JMX14_RS03565 | 720309..720605 | + | 297 | WP_000032534.1 | hypothetical protein | - |
| JMX14_RS03570 | 720668..720904 | + | 237 | WP_134912319.1 | DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| flank | IS/Tn | - | - | 717395..717547 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17585.56 Da Isoelectric Point: 8.5144
>T291123 WP_004889762.1 NZ_LR890471:715517-716002 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDSMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDSMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A447W563 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GVL4 |