Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 3960651..3961450 | Replicon | chromosome |
| Accession | NZ_LR890466 | ||
| Organism | Escherichia coli isolate MSB1_7A-sc-2280394 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | F0JQM9 |
| Locus tag | JMW16_RS18840 | Protein ID | WP_000347270.1 |
| Coordinates | 3960651..3961115 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | A0A0V9H1L4 |
| Locus tag | JMW16_RS18845 | Protein ID | WP_001551693.1 |
| Coordinates | 3961115..3961450 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW16_RS18810 | 3955652..3956086 | - | 435 | WP_000948837.1 | PTS sugar transporter subunit IIA | - |
| JMW16_RS18815 | 3956104..3956982 | - | 879 | WP_001295548.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
| JMW16_RS18820 | 3956972..3957751 | - | 780 | WP_000406214.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
| JMW16_RS18825 | 3957762..3958235 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| JMW16_RS18830 | 3958258..3959538 | - | 1281 | WP_001551694.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| JMW16_RS18835 | 3959787..3960596 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| JMW16_RS18840 | 3960651..3961115 | - | 465 | WP_000347270.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| JMW16_RS18845 | 3961115..3961450 | - | 336 | WP_001551693.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| JMW16_RS18850 | 3961599..3963170 | - | 1572 | WP_001273738.1 | galactarate dehydratase | - |
| JMW16_RS18855 | 3963545..3964879 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
| JMW16_RS18860 | 3964895..3965665 | + | 771 | WP_001551692.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17806.22 Da Isoelectric Point: 9.6924
>T291105 WP_000347270.1 NZ_LR890466:c3961115-3960651 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEAH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEAH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0V9NQ90 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0V9H1L4 |