Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 2147689..2148383 Replicon chromosome
Accession NZ_LR890466
Organism Escherichia coli isolate MSB1_7A-sc-2280394

Toxin (Protein)


Gene name yafO Uniprot ID Q0T7Q5
Locus tag JMW16_RS10405 Protein ID WP_001263491.1
Coordinates 2147689..2148087 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag JMW16_RS10410 Protein ID WP_000554755.1
Coordinates 2148090..2148383 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW16_RS10375 2142858..2144102 - 1245 WP_000189541.1 esterase FrsA -
- 2143518..2143598 - 81 NuclAT_10 - -
- 2143518..2143598 - 81 NuclAT_10 - -
- 2143518..2143598 - 81 NuclAT_10 - -
- 2143518..2143598 - 81 NuclAT_10 - -
JMW16_RS10380 2144194..2144652 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
JMW16_RS10385 2144913..2146370 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
JMW16_RS10390 2146427..2146779 - 353 Protein_2035 peptide chain release factor H -
JMW16_RS10395 2146775..2146981 - 207 Protein_2036 RtcB family protein -
JMW16_RS10400 2147227..2147679 - 453 WP_019842500.1 GNAT family N-acetyltransferase -
JMW16_RS10405 2147689..2148087 - 399 WP_001263491.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
JMW16_RS10410 2148090..2148383 - 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
JMW16_RS10415 2148435..2149490 - 1056 WP_001550655.1 DNA polymerase IV -
JMW16_RS10420 2149561..2150346 - 786 WP_019842510.1 putative lateral flagellar export/assembly protein LafU -
JMW16_RS10425 2150318..2152030 + 1713 Protein_2042 flagellar biosynthesis protein FlhA -
JMW16_RS10430 2152135..2152413 + 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
JMW16_RS10435 2152406..2152762 + 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2137625..2148383 10758


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15457.86 Da        Isoelectric Point: 8.0949

>T291097 WP_001263491.1 NZ_LR890466:c2148087-2147689 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT291097 WP_000554755.1 NZ_LR890466:c2148383-2148090 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TPK7

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References