Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 58476..59203 Replicon plasmid 2
Accession NZ_LR890465
Organism Klebsiella pneumoniae isolate INF079-sc-2280008

Toxin (Protein)


Gene name higB Uniprot ID A0A7W3D9W1
Locus tag JMW83_RS26115 Protein ID WP_011251285.1
Coordinates 58892..59203 (-) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag JMW83_RS26110 Protein ID WP_011251286.1
Coordinates 58476..58895 (-) Length 140 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW83_RS26080 53644..54114 - 471 WP_048333570.1 hypothetical protein -
JMW83_RS26085 54307..55062 - 756 Protein_50 hypothetical protein -
JMW83_RS26090 55658..56101 + 444 WP_048333569.1 hypothetical protein -
JMW83_RS26095 56122..56910 + 789 WP_040217257.1 hypothetical protein -
JMW83_RS26100 56924..57259 + 336 Protein_53 conjugal transfer protein TraI -
JMW83_RS26105 57361..58329 - 969 WP_074428168.1 IS5 family transposase -
JMW83_RS26110 58476..58895 - 420 WP_011251286.1 helix-turn-helix domain-containing protein Antitoxin
JMW83_RS26115 58892..59203 - 312 WP_011251285.1 type II toxin-antitoxin system HigB family toxin Toxin
JMW83_RS26120 59408..59866 - 459 Protein_57 DDE-type integrase/transposase/recombinase -
JMW83_RS26125 59980..60677 + 698 Protein_58 IS1 family transposase -
JMW83_RS26130 60694..61128 + 435 Protein_59 thioredoxin fold domain-containing protein -
JMW83_RS26135 61145..61456 + 312 WP_011251282.1 hypothetical protein -
JMW83_RS26140 61470..61811 + 342 WP_011251281.1 hypothetical protein -
JMW83_RS26145 61871..62827 + 957 WP_011251280.1 DsbA family protein -
JMW83_RS26150 62944..63519 + 576 WP_074424927.1 hypothetical protein -
JMW83_RS26155 63627..64028 + 402 Protein_64 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroB / iroC / iroD / iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 1..233932 233932
- inside IScluster/Tn - - 48355..65193 16838


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(22-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(85-138)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12346.12 Da        Isoelectric Point: 9.7248

>T291084 WP_011251285.1 NZ_LR890465:c59203-58892 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE

Download         Length: 312 bp

Antitoxin


Download         Length: 140 a.a.        Molecular weight: 15377.46 Da        Isoelectric Point: 4.4420

>AT291084 WP_011251286.1 NZ_LR890465:c58895-58476 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL

Download         Length: 420 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7W3D9W1

Antitoxin

Source ID Structure

References