Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 327680..328266 Replicon chromosome
Accession NZ_LR890464
Organism Klebsiella pneumoniae isolate INF079-sc-2280008

Toxin (Protein)


Gene name doc Uniprot ID A0A330WAT7
Locus tag JMW83_RS01520 Protein ID WP_014906830.1
Coordinates 327898..328266 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag JMW83_RS01515 Protein ID WP_004174006.1
Coordinates 327680..327901 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW83_RS01495 323837..324763 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
JMW83_RS01500 324760..326037 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
JMW83_RS01505 326034..326801 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
JMW83_RS01510 326803..327516 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
JMW83_RS01515 327680..327901 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMW83_RS01520 327898..328266 + 369 WP_014906830.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JMW83_RS01525 328539..329855 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
JMW83_RS01530 329962..330849 + 888 WP_014906831.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
JMW83_RS01535 330846..331691 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
JMW83_RS01540 331693..332763 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 324760..333500 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(28-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13537.95 Da        Isoelectric Point: 8.6410

>T291072 WP_014906830.1 NZ_LR890464:327898-328266 [Klebsiella pneumoniae]
MTLQIISAEEIILFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT291072 WP_004174006.1 NZ_LR890464:327680-327901 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A330WAT7

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References