Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 3891190..3891787 | Replicon | chromosome |
Accession | NZ_LR890457 | ||
Organism | Klebsiella pneumoniae isolate KSB1_6G-sc-2280276 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A9J6S5A1 |
Locus tag | JMX47_RS19230 | Protein ID | WP_004893639.1 |
Coordinates | 3891470..3891787 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | R4YH91 |
Locus tag | JMX47_RS19225 | Protein ID | WP_004142561.1 |
Coordinates | 3891190..3891477 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMX47_RS19195 | 3887397..3887645 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
JMX47_RS19200 | 3887663..3888004 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
JMX47_RS19205 | 3888035..3889150 | - | 1116 | WP_074180844.1 | MBL fold metallo-hydrolase | - |
JMX47_RS19210 | 3889330..3889911 | + | 582 | WP_004176968.1 | TetR/AcrR family transcriptional regulator | - |
JMX47_RS19215 | 3889911..3890279 | + | 369 | WP_004142557.1 | MmcQ/YjbR family DNA-binding protein | - |
JMX47_RS19220 | 3890399..3891052 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
JMX47_RS19225 | 3891190..3891477 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
JMX47_RS19230 | 3891470..3891787 | - | 318 | WP_004893639.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMX47_RS19235 | 3891972..3893015 | - | 1044 | WP_023279204.1 | DUF2157 domain-containing protein | - |
JMX47_RS19240 | 3893685..3894551 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
JMX47_RS19245 | 3894660..3896087 | + | 1428 | WP_004176980.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12100.35 Da Isoelectric Point: 11.2767
>T291059 WP_004893639.1 NZ_LR890457:c3891787-3891470 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPSIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPSIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|