Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 362719..363365 | Replicon | chromosome |
Accession | NZ_LR890456 | ||
Organism | Klebsiella pneumoniae isolate INF032-sc-2279918 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A6G4MDN2 |
Locus tag | JMV68_RS01690 | Protein ID | WP_064148407.1 |
Coordinates | 362719..363045 (+) | Length | 109 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | JMV68_RS01695 | Protein ID | WP_064148406.1 |
Coordinates | 363066..363365 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV68_RS01680 | 358645..360078 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
JMV68_RS01685 | 360096..362543 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
JMV68_RS01690 | 362719..363045 | + | 327 | WP_064148407.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMV68_RS01695 | 363066..363365 | + | 300 | WP_064148406.1 | helix-turn-helix transcriptional regulator | Antitoxin |
JMV68_RS01700 | 363428..364936 | - | 1509 | WP_064148405.1 | glycerol-3-phosphate dehydrogenase | - |
JMV68_RS01705 | 365141..365470 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
JMV68_RS01710 | 365521..366351 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
JMV68_RS01715 | 366401..367159 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 12625.53 Da Isoelectric Point: 5.1769
>T291038 WP_064148407.1 NZ_LR890456:362719-363045 [Klebsiella pneumoniae]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFS
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFS
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|