Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 336531..337117 Replicon chromosome
Accession NZ_LR890456
Organism Klebsiella pneumoniae isolate INF032-sc-2279918

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag JMV68_RS01580 Protein ID WP_021312828.1
Coordinates 336749..337117 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag JMV68_RS01575 Protein ID WP_004174006.1
Coordinates 336531..336752 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMV68_RS01555 332688..333614 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
JMV68_RS01560 333611..334888 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
JMV68_RS01565 334885..335652 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
JMV68_RS01570 335654..336367 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
JMV68_RS01575 336531..336752 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMV68_RS01580 336749..337117 + 369 WP_021312828.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JMV68_RS01585 337390..338706 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
JMV68_RS01590 338813..339700 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
JMV68_RS01595 339697..340542 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
JMV68_RS01600 340544..341614 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 333611..342351 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13578.96 Da        Isoelectric Point: 8.5493

>T291037 WP_021312828.1 NZ_LR890456:336749-337117 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGYIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT291037 WP_004174006.1 NZ_LR890456:336531-336752 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References