Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 339062..339648 Replicon chromosome
Accession NZ_LR890446
Organism Klebsiella pneumoniae isolate INF171-sc-2280028

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag JMW80_RS01565 Protein ID WP_201525651.1
Coordinates 339280..339648 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag JMW80_RS01560 Protein ID WP_004174006.1
Coordinates 339062..339283 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW80_RS01540 335218..336144 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
JMW80_RS01545 336141..337418 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
JMW80_RS01550 337415..338182 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
JMW80_RS01555 338184..338897 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
JMW80_RS01560 339062..339283 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMW80_RS01565 339280..339648 + 369 WP_201525651.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JMW80_RS01570 339921..341237 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
JMW80_RS01575 341344..342231 + 888 WP_014906831.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
JMW80_RS01580 342228..343073 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
JMW80_RS01585 343075..344145 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 336141..344882 8741


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13584.04 Da        Isoelectric Point: 8.6410

>T291021 WP_201525651.1 NZ_LR890446:339280-339648 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRMLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGIKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT291021 WP_004174006.1 NZ_LR890446:339062-339283 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References