Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 4101031..4101710 | Replicon | chromosome |
Accession | NZ_LR890410 | ||
Organism | Escherichia coli isolate MSB2_1A-sc-2280429 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | JMW04_RS19435 | Protein ID | WP_000057523.1 |
Coordinates | 4101031..4101333 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | JMW04_RS19440 | Protein ID | WP_000806442.1 |
Coordinates | 4101369..4101710 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW04_RS19415 | 4096294..4097514 | - | 1221 | WP_001773866.1 | fosmidomycin MFS transporter | - |
JMW04_RS19420 | 4097732..4099384 | + | 1653 | WP_001773867.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
JMW04_RS19425 | 4099421..4099900 | - | 480 | WP_001538397.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
JMW04_RS19430 | 4100104..4100898 | - | 795 | WP_001538398.1 | TraB/GumN family protein | - |
JMW04_RS19435 | 4101031..4101333 | + | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMW04_RS19440 | 4101369..4101710 | + | 342 | WP_000806442.1 | HigA family addiction module antidote protein | Antitoxin |
JMW04_RS19445 | 4101768..4104272 | - | 2505 | WP_000083948.1 | copper-exporting P-type ATPase CopA | - |
JMW04_RS19450 | 4104534..4105466 | + | 933 | WP_001538399.1 | glutaminase A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T290933 WP_000057523.1 NZ_LR890410:4101031-4101333 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|