Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3872450..3873144 | Replicon | chromosome |
| Accession | NZ_LR890410 | ||
| Organism | Escherichia coli isolate MSB2_1A-sc-2280429 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1PJQ2 |
| Locus tag | JMW04_RS18395 | Protein ID | WP_001263500.1 |
| Coordinates | 3872746..3873144 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | JMW04_RS18390 | Protein ID | WP_000554758.1 |
| Coordinates | 3872450..3872743 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW04_RS18365 | 3868267..3868734 | + | 468 | WP_000725261.1 | flagellar basal body-associated FliL family protein | - |
| JMW04_RS18370 | 3868754..3869470 | + | 717 | WP_000938731.1 | FliA/WhiG family RNA polymerase sigma factor | - |
| JMW04_RS18375 | 3869483..3870346 | + | 864 | WP_001169518.1 | flagellar motor stator protein MotA | - |
| JMW04_RS18380 | 3870349..3871272 | + | 924 | WP_001532973.1 | putative lateral flagellar export/assembly protein LafU | - |
| JMW04_RS18385 | 3871343..3872398 | + | 1056 | WP_001226168.1 | DNA polymerase IV | - |
| JMW04_RS18390 | 3872450..3872743 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| JMW04_RS18395 | 3872746..3873144 | + | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| JMW04_RS18400 | 3873154..3873606 | + | 453 | WP_001059895.1 | GNAT family N-acetyltransferase | - |
| JMW04_RS18405 | 3873796..3874935 | + | 1140 | WP_000521561.1 | RNA ligase RtcB family protein | - |
| JMW04_RS18410 | 3874932..3875546 | + | 615 | WP_000602124.1 | peptide chain release factor H | - |
| JMW04_RS18415 | 3875603..3877060 | - | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
| JMW04_RS18420 | 3877321..3877779 | + | 459 | WP_001291991.1 | xanthine phosphoribosyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T290931 WP_001263500.1 NZ_LR890410:3872746-3873144 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|