Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 2875733..2876335 | Replicon | chromosome |
| Accession | NZ_LR890410 | ||
| Organism | Escherichia coli isolate MSB2_1A-sc-2280429 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | JMW04_RS13660 | Protein ID | WP_000897302.1 |
| Coordinates | 2875733..2876044 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | JMW04_RS13665 | Protein ID | WP_000356397.1 |
| Coordinates | 2876045..2876335 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW04_RS13630 | 2870763..2871548 | + | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| JMW04_RS13635 | 2871647..2872246 | + | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
| JMW04_RS13640 | 2872240..2873112 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| JMW04_RS13645 | 2873109..2873546 | + | 438 | WP_000560978.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
| JMW04_RS13650 | 2873591..2874532 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| JMW04_RS13655 | 2874596..2875504 | - | 909 | WP_001774092.1 | alpha/beta hydrolase | - |
| JMW04_RS13660 | 2875733..2876044 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| JMW04_RS13665 | 2876045..2876335 | + | 291 | WP_000356397.1 | helix-turn-helix domain-containing protein | Antitoxin |
| JMW04_RS13670 | 2876694..2876972 | + | 279 | WP_001296612.1 | hypothetical protein | - |
| JMW04_RS13675 | 2877368..2877586 | + | 219 | WP_001314326.1 | ribbon-helix-helix domain-containing protein | - |
| JMW04_RS13680 | 2877802..2878731 | - | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| JMW04_RS13685 | 2878728..2879363 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| JMW04_RS13690 | 2879360..2880262 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T290921 WP_000897302.1 NZ_LR890410:2875733-2876044 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|