Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1834921..1835101 | Replicon | chromosome |
Accession | NC_020536 | ||
Organism | Staphylococcus aureus subsp. aureus ST228 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | SAI6T6_RS15980 | Protein ID | WP_001801861.1 |
Coordinates | 1834921..1835016 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1835044..1835101 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAI6T6_RS08860 | 1830084..1830734 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
SAI6T6_RS08865 | 1830815..1831810 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
SAI6T6_RS08870 | 1831885..1832511 | + | 627 | WP_000669024.1 | hypothetical protein | - |
SAI6T6_RS08875 | 1832552..1832893 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
SAI6T6_RS08880 | 1832994..1833566 | + | 573 | WP_000414216.1 | hypothetical protein | - |
SAI6T6_RS15620 | 1833764..1834776 | - | 1013 | Protein_1701 | IS3 family transposase | - |
SAI6T6_RS15980 | 1834921..1835016 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1835044..1835101 | - | 58 | - | - | Antitoxin |
SAI6T6_RS14765 | 1835139..1835240 | + | 102 | WP_001792025.1 | hypothetical protein | - |
SAI6T6_RS15985 | 1835218..1835379 | - | 162 | Protein_1704 | transposase | - |
SAI6T6_RS08905 | 1835370..1835864 | - | 495 | Protein_1705 | transposase | - |
SAI6T6_RS08910 | 1836316..1837544 | - | 1229 | Protein_1706 | restriction endonuclease subunit S | - |
SAI6T6_RS08915 | 1837537..1839092 | - | 1556 | Protein_1707 | type I restriction-modification system subunit M | - |
SAI6T6_RS14770 | 1839256..1839390 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA / selk | 1810778..1909641 | 98863 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T29092 WP_001801861.1 NC_020536:1834921-1835016 [Staphylococcus aureus subsp. aureus ST228]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T29092 NC_020536:1834921-1835016 [Staphylococcus aureus subsp. aureus ST228]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT29092 NC_020536:c1835101-1835044 [Staphylococcus aureus subsp. aureus ST228]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|