Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1992891..1993618 | Replicon | chromosome |
| Accession | NZ_LR890410 | ||
| Organism | Escherichia coli isolate MSB2_1A-sc-2280429 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9ZMR4 |
| Locus tag | JMW04_RS09445 | Protein ID | WP_000550189.1 |
| Coordinates | 1993304..1993618 (-) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | JMW04_RS09440 | Protein ID | WP_000560266.1 |
| Coordinates | 1992891..1993307 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW04_RS09430 | 1988051..1990402 | + | 2352 | WP_000695487.1 | alpha-glucosidase | - |
| JMW04_RS09435 | 1990828..1992846 | + | 2019 | WP_000121433.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| JMW04_RS09440 | 1992891..1993307 | - | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| JMW04_RS09445 | 1993304..1993618 | - | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| JMW04_RS09450 | 1993902..1995038 | - | 1137 | WP_000018695.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| JMW04_RS09455 | 1995123..1995626 | + | 504 | WP_001333820.1 | M48 family metallopeptidase | - |
| JMW04_RS09460 | 1995703..1996395 | + | 693 | WP_000942548.1 | vancomycin high temperature exclusion protein | - |
| JMW04_RS09465 | 1996474..1997460 | + | 987 | WP_000617698.1 | Gfo/Idh/MocA family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T290919 WP_000550189.1 NZ_LR890410:c1993618-1993304 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT290919 WP_000560266.1 NZ_LR890410:c1993307-1992891 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|