Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 1928350..1929043 | Replicon | chromosome |
Accession | NZ_LR890410 | ||
Organism | Escherichia coli isolate MSB2_1A-sc-2280429 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | JMW04_RS09140 | Protein ID | WP_000415584.1 |
Coordinates | 1928747..1929043 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | JMW04_RS09135 | Protein ID | WP_000650107.1 |
Coordinates | 1928350..1928745 (-) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW04_RS09125 | 1924214..1926472 | - | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
JMW04_RS09130 | 1926610..1928217 | - | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
JMW04_RS09135 | 1928350..1928745 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
JMW04_RS09140 | 1928747..1929043 | - | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
JMW04_RS09145 | 1929248..1929730 | - | 483 | WP_000183505.1 | transcriptional regulator | - |
JMW04_RS09150 | 1929783..1930175 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
JMW04_RS09155 | 1930327..1930986 | + | 660 | WP_001221493.1 | two-component system response regulator QseB | - |
JMW04_RS09160 | 1930983..1932332 | + | 1350 | WP_000673402.1 | two-component system sensor histidine kinase QseC | - |
JMW04_RS09165 | 1932378..1932710 | - | 333 | WP_000917685.1 | DUF2645 family protein | - |
JMW04_RS09170 | 1933029..1933610 | + | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
JMW04_RS09175 | 1933641..1933955 | + | 315 | WP_000958598.1 | antibiotic biosynthesis monooxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1919887..1929043 | 9156 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T290918 WP_000415584.1 NZ_LR890410:c1929043-1928747 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT290918 WP_000650107.1 NZ_LR890410:c1928745-1928350 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|