Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3994732..3995382 | Replicon | chromosome |
Accession | NZ_LR890405 | ||
Organism | Escherichia coli isolate MSB1_7C-sc-2280317 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | JMW09_RS19260 | Protein ID | WP_000263532.1 |
Coordinates | 3995041..3995382 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | U9YXQ7 |
Locus tag | JMW09_RS19255 | Protein ID | WP_000212552.1 |
Coordinates | 3994732..3995031 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW09_RS19230 | 3990180..3990491 | - | 312 | WP_000415004.1 | hypothetical protein | - |
JMW09_RS19235 | 3990496..3990888 | - | 393 | WP_000285322.1 | flagellar export chaperone FliS | - |
JMW09_RS19240 | 3990911..3992227 | - | 1317 | WP_000609678.1 | flagellar filament capping protein FliD | - |
JMW09_RS19245 | 3992432..3993346 | - | 915 | WP_000949083.1 | lateral flagellin LafA | - |
JMW09_RS19250 | 3993832..3994674 | + | 843 | WP_000022366.1 | winged helix-turn-helix domain-containing protein | - |
JMW09_RS19255 | 3994732..3995031 | - | 300 | WP_000212552.1 | helix-turn-helix transcriptional regulator | Antitoxin |
JMW09_RS19260 | 3995041..3995382 | - | 342 | WP_000263532.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMW09_RS19265 | 3995458..3996435 | - | 978 | WP_001195938.1 | hypothetical protein | - |
JMW09_RS19270 | 3996452..3997381 | - | 930 | WP_001266799.1 | flagellar hook-associated protein FlgL | - |
JMW09_RS19275 | 3997396..3998772 | - | 1377 | WP_000367245.1 | flagellar hook-associated protein FlgK | - |
JMW09_RS19280 | 3998948..3999247 | - | 300 | WP_000867281.1 | rod-binding protein | - |
JMW09_RS19285 | 3999247..4000347 | - | 1101 | WP_001181876.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13031.86 Da Isoelectric Point: 6.4677
>T290898 WP_000263532.1 NZ_LR890405:c3995382-3995041 [Escherichia coli]
MWDVETTETFDNWFDAQTVALKEDLLAAMLILAEYGPQLGRPFADTVNDSQFSNMKELRVQHQGNPVRAFFAFDPARRGI
VLCAGDKTGLNEKKFYRDMIKLADSEYRKHLKK
MWDVETTETFDNWFDAQTVALKEDLLAAMLILAEYGPQLGRPFADTVNDSQFSNMKELRVQHQGNPVRAFFAFDPARRGI
VLCAGDKTGLNEKKFYRDMIKLADSEYRKHLKK
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|