Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 741087..741780 | Replicon | chromosome |
Accession | NZ_LR890405 | ||
Organism | Escherichia coli isolate MSB1_7C-sc-2280317 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | JMW09_RS03565 | Protein ID | WP_000415584.1 |
Coordinates | 741087..741383 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | JMW09_RS03570 | Protein ID | WP_000650107.1 |
Coordinates | 741385..741780 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW09_RS03530 | 736166..736480 | - | 315 | WP_000958598.1 | antibiotic biosynthesis monooxygenase | - |
JMW09_RS03535 | 736511..737092 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
JMW09_RS03540 | 737420..737752 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
JMW09_RS03545 | 737798..739147 | - | 1350 | WP_000673402.1 | two-component system sensor histidine kinase QseC | - |
JMW09_RS03550 | 739144..739803 | - | 660 | WP_001221493.1 | two-component system response regulator QseB | - |
JMW09_RS03555 | 739955..740347 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
JMW09_RS03560 | 740400..740882 | + | 483 | WP_000183505.1 | transcriptional regulator | - |
JMW09_RS03565 | 741087..741383 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
JMW09_RS03570 | 741385..741780 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
JMW09_RS03575 | 741913..743520 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
JMW09_RS03580 | 743658..745916 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T290884 WP_000415584.1 NZ_LR890405:741087-741383 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT290884 WP_000650107.1 NZ_LR890405:741385-741780 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|