Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 634714..635513 | Replicon | chromosome |
Accession | NZ_LR890405 | ||
Organism | Escherichia coli isolate MSB1_7C-sc-2280317 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | B7NDB6 |
Locus tag | JMW09_RS03040 | Protein ID | WP_000347269.1 |
Coordinates | 634714..635178 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | V0YUB5 |
Locus tag | JMW09_RS03045 | Protein ID | WP_001309780.1 |
Coordinates | 635178..635513 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW09_RS03010 | 629715..630149 | - | 435 | WP_000948818.1 | PTS sugar transporter subunit IIA | - |
JMW09_RS03015 | 630167..631045 | - | 879 | WP_001295548.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
JMW09_RS03020 | 631035..631814 | - | 780 | WP_000406214.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
JMW09_RS03025 | 631825..632298 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
JMW09_RS03030 | 632321..633601 | - | 1281 | WP_000681943.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
JMW09_RS03035 | 633850..634659 | + | 810 | WP_000072171.1 | aga operon transcriptional regulator AgaR | - |
JMW09_RS03040 | 634714..635178 | - | 465 | WP_000347269.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
JMW09_RS03045 | 635178..635513 | - | 336 | WP_001309780.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
JMW09_RS03050 | 635662..637233 | - | 1572 | WP_001273738.1 | galactarate dehydratase | - |
JMW09_RS03055 | 637608..638942 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
JMW09_RS03060 | 638958..639728 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17806.22 Da Isoelectric Point: 9.6924
>T290882 WP_000347269.1 NZ_LR890405:c635178-634714 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTREAEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTREAEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829IY86 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0YUB5 |