Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2156685..2156901 | Replicon | chromosome |
Accession | NC_020533 | ||
Organism | Staphylococcus aureus subsp. aureus ST228 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | SAI4T8_RS10860 | Protein ID | WP_001802298.1 |
Coordinates | 2156797..2156901 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2156685..2156740 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAI4T8_RS10840 | 2152244..2152621 | - | 378 | WP_000361059.1 | transposase | - |
SAI4T8_RS10845 | 2152628..2154520 | - | 1893 | WP_001557544.1 | site-specific integrase | - |
SAI4T8_RS10850 | 2154517..2155602 | - | 1086 | WP_000868132.1 | tyrosine-type recombinase/integrase | - |
SAI4T8_RS10855 | 2155720..2156364 | + | 645 | Protein_2045 | transcriptional regulator | - |
- | 2156685..2156740 | + | 56 | - | - | Antitoxin |
SAI4T8_RS10860 | 2156797..2156901 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
SAI4T8_RS14625 | 2157581..2157739 | + | 159 | WP_001792784.1 | hypothetical protein | - |
SAI4T8_RS10865 | 2158397..2159254 | - | 858 | WP_015445908.1 | Cof-type HAD-IIB family hydrolase | - |
SAI4T8_RS10870 | 2159322..2160104 | - | 783 | WP_000908182.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T29085 WP_001802298.1 NC_020533:c2156901-2156797 [Staphylococcus aureus subsp. aureus ST228]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T29085 NC_020533:c2156901-2156797 [Staphylococcus aureus subsp. aureus ST228]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT29085 NC_020533:2156685-2156740 [Staphylococcus aureus subsp. aureus ST228]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|