Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 337662..338248 Replicon chromosome
Accession NZ_LR890374
Organism Klebsiella pneumoniae isolate INF250-sc-2280154

Toxin (Protein)


Gene name doc Uniprot ID A0A331ME34
Locus tag JMW58_RS01575 Protein ID WP_025861226.1
Coordinates 337880..338248 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag JMW58_RS01570 Protein ID WP_004174006.1
Coordinates 337662..337883 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW58_RS01550 333818..334744 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
JMW58_RS01555 334741..336018 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
JMW58_RS01560 336015..336782 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
JMW58_RS01565 336784..337497 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
JMW58_RS01570 337662..337883 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMW58_RS01575 337880..338248 + 369 WP_025861226.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JMW58_RS01580 338521..339837 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
JMW58_RS01585 339944..340831 + 888 WP_014906831.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
JMW58_RS01590 340828..341673 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
JMW58_RS01595 341675..342745 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 334741..343482 8741


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13551.98 Da        Isoelectric Point: 8.6410

>T290801 WP_025861226.1 NZ_LR890374:337880-338248 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGIKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT290801 WP_004174006.1 NZ_LR890374:337662-337883 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A331ME34

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References