Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 365293..365939 | Replicon | chromosome |
Accession | NZ_LR890369 | ||
Organism | Klebsiella pneumoniae isolate INF354-sc-2280183 |
Toxin (Protein)
Gene name | higB | Uniprot ID | W9BBY1 |
Locus tag | JMW41_RS01690 | Protein ID | WP_016529833.1 |
Coordinates | 365293..365640 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A231WWU8 |
Locus tag | JMW41_RS01695 | Protein ID | WP_004174017.1 |
Coordinates | 365640..365939 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW41_RS01680 | 361219..362652 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
JMW41_RS01685 | 362670..365117 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
JMW41_RS01690 | 365293..365640 | + | 348 | WP_016529833.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JMW41_RS01695 | 365640..365939 | + | 300 | WP_004174017.1 | XRE family transcriptional regulator | Antitoxin |
JMW41_RS01700 | 366002..367510 | - | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
JMW41_RS01705 | 367715..368044 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
JMW41_RS01710 | 368095..368925 | + | 831 | WP_032428425.1 | rhomboid family intramembrane serine protease GlpG | - |
JMW41_RS01715 | 368975..369733 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13549.56 Da Isoelectric Point: 5.6749
>T290783 WP_016529833.1 NZ_LR890369:365293-365640 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | W9BBY1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A231WWU8 |