Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3952054..3952748 Replicon chromosome
Accession NZ_LR890349
Organism Escherichia coli isolate MSB1_9D-sc-2280338

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag JMW03_RS19285 Protein ID WP_001263493.1
Coordinates 3952054..3952452 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag JMW03_RS19290 Protein ID WP_000554757.1
Coordinates 3952455..3952748 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW03_RS19255 3947054..3948298 - 1245 WP_073464911.1 esterase FrsA -
- 3947714..3947794 - 81 NuclAT_10 - -
- 3947714..3947794 - 81 NuclAT_10 - -
- 3947714..3947794 - 81 NuclAT_10 - -
- 3947714..3947794 - 81 NuclAT_10 - -
JMW03_RS19260 3948390..3948848 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
JMW03_RS19265 3949109..3950566 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
JMW03_RS19270 3950623..3951144 - 522 Protein_3774 peptide chain release factor H -
JMW03_RS19275 3951143..3951346 - 204 Protein_3775 RNA ligase RtcB family protein -
JMW03_RS19280 3951592..3952044 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
JMW03_RS19285 3952054..3952452 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
JMW03_RS19290 3952455..3952748 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
JMW03_RS19295 3952800..3953855 - 1056 WP_001226164.1 DNA polymerase IV -
JMW03_RS19300 3953926..3954711 - 786 WP_000207587.1 putative lateral flagellar export/assembly protein LafU -
JMW03_RS19305 3954683..3956395 + 1713 Protein_3781 flagellar biosynthesis protein FlhA -
JMW03_RS19310 3956619..3957116 - 498 WP_000006242.1 REP-associated tyrosine transposase RayT -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - gmhA/lpcA / rhs/PAAR 3934158..3970884 36726


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T290744 WP_001263493.1 NZ_LR890349:c3952452-3952054 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT290744 WP_000554757.1 NZ_LR890349:c3952748-3952455 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References