Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 729270..729997 | Replicon | chromosome |
Accession | NZ_LR890349 | ||
Organism | Escherichia coli isolate MSB1_9D-sc-2280338 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | JMW03_RS03515 | Protein ID | WP_000550189.1 |
Coordinates | 729270..729584 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | JMW03_RS03520 | Protein ID | WP_001514564.1 |
Coordinates | 729581..729997 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW03_RS03495 | 725427..726413 | - | 987 | WP_000617698.1 | Gfo/Idh/MocA family oxidoreductase | - |
JMW03_RS03500 | 726492..727184 | - | 693 | WP_000942548.1 | vancomycin high temperature exclusion protein | - |
JMW03_RS03505 | 727261..727764 | - | 504 | WP_001300832.1 | M48 family metallopeptidase | - |
JMW03_RS03510 | 727849..728985 | + | 1137 | WP_001514565.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
JMW03_RS03515 | 729270..729584 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
JMW03_RS03520 | 729581..729997 | + | 417 | WP_001514564.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
JMW03_RS03525 | 730042..732060 | - | 2019 | WP_001544111.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
JMW03_RS03530 | 732486..734837 | - | 2352 | WP_001514561.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T290733 WP_000550189.1 NZ_LR890349:729270-729584 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15025.44 Da Isoelectric Point: 4.4547
>AT290733 WP_001514564.1 NZ_LR890349:729581-729997 [Escherichia coli]
MITIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MITIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|