Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 679675..680474 | Replicon | chromosome |
| Accession | NZ_LR890349 | ||
| Organism | Escherichia coli isolate MSB1_9D-sc-2280338 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | S1NYM6 |
| Locus tag | JMW03_RS03265 | Protein ID | WP_000347251.1 |
| Coordinates | 679675..680139 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | D6JF08 |
| Locus tag | JMW03_RS03270 | Protein ID | WP_001308975.1 |
| Coordinates | 680139..680474 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW03_RS03235 | 674676..675110 | - | 435 | WP_000948824.1 | PTS sugar transporter subunit IIA | - |
| JMW03_RS03240 | 675128..676006 | - | 879 | WP_001300474.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
| JMW03_RS03245 | 675996..676775 | - | 780 | WP_000406214.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
| JMW03_RS03250 | 676786..677259 | - | 474 | WP_201514308.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| JMW03_RS03255 | 677282..678562 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| JMW03_RS03260 | 678811..679620 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| JMW03_RS03265 | 679675..680139 | - | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| JMW03_RS03270 | 680139..680474 | - | 336 | WP_001308975.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| JMW03_RS03275 | 680623..682194 | - | 1572 | WP_201514310.1 | galactarate dehydratase | - |
| JMW03_RS03280 | 682569..683903 | + | 1335 | WP_137471965.1 | galactarate/glucarate/glycerate transporter GarP | - |
| JMW03_RS03285 | 683919..684689 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T290732 WP_000347251.1 NZ_LR890349:c680139-679675 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJ20 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | D6JF08 |