Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2441626..2441810 | Replicon | chromosome |
Accession | NC_020532 | ||
Organism | Staphylococcus aureus subsp. aureus ST228 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | SAI3T3_RS15105 | Protein ID | WP_000482652.1 |
Coordinates | 2441703..2441810 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2441626..2441686 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAI3T3_RS15090 | 2437081..2437248 | - | 168 | Protein_2329 | hypothetical protein | - |
SAI3T3_RS12340 | 2437479..2439212 | - | 1734 | WP_000486483.1 | ABC transporter ATP-binding protein/permease | - |
SAI3T3_RS12345 | 2439237..2441000 | - | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein/permease | - |
- | 2441626..2441686 | + | 61 | - | - | Antitoxin |
SAI3T3_RS15105 | 2441703..2441810 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
SAI3T3_RS12360 | 2441944..2442330 | - | 387 | WP_000779360.1 | flippase GtxA | - |
SAI3T3_RS12365 | 2442598..2443740 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
SAI3T3_RS12370 | 2443800..2444459 | + | 660 | WP_000831302.1 | hypothetical protein | - |
SAI3T3_RS12375 | 2444641..2445852 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
SAI3T3_RS12380 | 2445975..2446448 | - | 474 | WP_015445934.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T29073 WP_000482652.1 NC_020532:c2441810-2441703 [Staphylococcus aureus subsp. aureus ST228]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T29073 NC_020532:c2441810-2441703 [Staphylococcus aureus subsp. aureus ST228]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT29073 NC_020532:2441626-2441686 [Staphylococcus aureus subsp. aureus ST228]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|