Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 4333945..4334591 | Replicon | chromosome |
| Accession | NZ_LR890343 | ||
| Organism | Klebsiella pneumoniae isolate KSB2_2B-sc-2280339 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A332YAY3 |
| Locus tag | JMW06_RS20715 | Protein ID | WP_032435150.1 |
| Coordinates | 4333945..4334292 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | W8UB68 |
| Locus tag | JMW06_RS20720 | Protein ID | WP_002920557.1 |
| Coordinates | 4334292..4334591 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW06_RS20705 | 4329871..4331304 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
| JMW06_RS20710 | 4331322..4333769 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
| JMW06_RS20715 | 4333945..4334292 | + | 348 | WP_032435150.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JMW06_RS20720 | 4334292..4334591 | + | 300 | WP_002920557.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| JMW06_RS20725 | 4334654..4336162 | - | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
| JMW06_RS20730 | 4336367..4336696 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
| JMW06_RS20735 | 4336747..4337577 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
| JMW06_RS20740 | 4337627..4338385 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13531.52 Da Isoelectric Point: 5.6749
>T290728 WP_032435150.1 NZ_LR890343:4333945-4334292 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATILILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATILILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A332YAY3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E1CBF8 |