Detailed information of TA system TA290706

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 85809..86138
• Replicon: plasmid 2
• Accession: NZ_LR890335
• Organism: Escherichia coli isolate MINF_9A-sc-2280436

Toxin (Protein)

• Gene name: hok
• Uniprot ID: P11895
• Locus tag: JMW07_RS25255
• Protein ID: WP_001312861.1
• Coordinates: 85809..85967 (-)
• Length: 53 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	86011..86138 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
JMW07_RS25210	80921..81148	-	228	WP_001254388.1	conjugal transfer relaxosome protein TraY	-
JMW07_RS25215	81236..81913	-	678	WP_001348626.1	PAS domain-containing protein	-
JMW07_RS25220	82047..82430	-	384	WP_001151566.1	relaxosome protein TraM	-
JMW07_RS25225	82761..83363	+	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
JMW07_RS25230	83660..84481	-	822	WP_001234469.1	DUF945 domain-containing protein	-
JMW07_RS25235	84600..84887	-	288	WP_000107535.1	hypothetical protein	-
JMW07_RS25240	84912..85118	-	207	WP_000275859.1	hypothetical protein	-
JMW07_RS25245	85031..85366	-	336	WP_013023876.1	hypothetical protein	-
JMW07_RS25250	85359..85514	-	156	WP_001380190.1	hypothetical protein	-
JMW07_RS25255	85809..85967	-	159	WP_001312861.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	86011..86138	-	128	NuclAT_0	-	Antitoxin
-	86011..86138	-	128	NuclAT_0	-	Antitoxin
-	86011..86138	-	128	NuclAT_0	-	Antitoxin
-	86011..86138	-	128	NuclAT_0	-	Antitoxin
-	87580..87682	-	103	NuclAT_1	-	-
-	87580..87682	-	103	NuclAT_1	-	-
-	87580..87682	-	103	NuclAT_1	-	-
-	87580..87682	-	103	NuclAT_1	-	-
JMW07_RS25265	87694..88413	-	720	WP_001276232.1	plasmid SOS inhibition protein A	-
JMW07_RS25270	88410..88844	-	435	WP_000845940.1	conjugation system SOS inhibitor PsiB	-
JMW07_RS25275	88899..90857	-	1959	WP_000117179.1	ParB/RepB/Spo0J family partition protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 / sitABCD	iucA / iucB / iucC / iucD / iutA	1..139312	139312

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (8-48)

Sequences

Toxin

Protein

• Length: 53 a.a.
• Molecular weight: 6082.32 Da
• Isoelectric Point: 9.2584

>T290706 WP_001312861.1 NZ_LR890335:c85967-85809 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 159 bp

Antitoxin

Nucleotide

• Length: 128 bp

>AT290706 NZ_LR890335:c86138-86011 [Escherichia coli]
CGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTAA
GTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Toxin

• AlphaFold DB: P11895

Antitoxin