Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 85809..86138 | Replicon | plasmid 2 |
| Accession | NZ_LR890335 | ||
| Organism | Escherichia coli isolate MINF_9A-sc-2280436 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | JMW07_RS25255 | Protein ID | WP_001312861.1 |
| Coordinates | 85809..85967 (-) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 86011..86138 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW07_RS25210 | 80921..81148 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
| JMW07_RS25215 | 81236..81913 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| JMW07_RS25220 | 82047..82430 | - | 384 | WP_001151566.1 | relaxosome protein TraM | - |
| JMW07_RS25225 | 82761..83363 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| JMW07_RS25230 | 83660..84481 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| JMW07_RS25235 | 84600..84887 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| JMW07_RS25240 | 84912..85118 | - | 207 | WP_000275859.1 | hypothetical protein | - |
| JMW07_RS25245 | 85031..85366 | - | 336 | WP_013023876.1 | hypothetical protein | - |
| JMW07_RS25250 | 85359..85514 | - | 156 | WP_001380190.1 | hypothetical protein | - |
| JMW07_RS25255 | 85809..85967 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 86011..86138 | - | 128 | NuclAT_0 | - | Antitoxin |
| - | 86011..86138 | - | 128 | NuclAT_0 | - | Antitoxin |
| - | 86011..86138 | - | 128 | NuclAT_0 | - | Antitoxin |
| - | 86011..86138 | - | 128 | NuclAT_0 | - | Antitoxin |
| - | 87580..87682 | - | 103 | NuclAT_1 | - | - |
| - | 87580..87682 | - | 103 | NuclAT_1 | - | - |
| - | 87580..87682 | - | 103 | NuclAT_1 | - | - |
| - | 87580..87682 | - | 103 | NuclAT_1 | - | - |
| JMW07_RS25265 | 87694..88413 | - | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
| JMW07_RS25270 | 88410..88844 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| JMW07_RS25275 | 88899..90857 | - | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 / sitABCD | iucA / iucB / iucC / iucD / iutA | 1..139312 | 139312 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T290706 WP_001312861.1 NZ_LR890335:c85967-85809 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
Antitoxin
Download Length: 128 bp
>AT290706 NZ_LR890335:c86138-86011 [Escherichia coli]
CGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTAA
GTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
CGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTAA
GTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|