Detailed information of TA system TA290705

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 61109..61348
• Replicon: plasmid 2
• Accession: NZ_LR890335
• Organism: Escherichia coli isolate MINF_9A-sc-2280436

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: A0A762TWR7
• Locus tag: JMW07_RS25110
• Protein ID: WP_023144756.1
• Coordinates: 61109..61243 (-)
• Length: 45 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	61288..61348 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
JMW07_RS25070	56596..56736	-	141	WP_001333237.1	hypothetical protein	-
JMW07_RS25075	57438..58295	-	858	WP_000130640.1	incFII family plasmid replication initiator RepA	-
JMW07_RS25080	58288..58362	-	75	WP_031943482.1	RepA leader peptide Tap	-
JMW07_RS25085	58359..58493	-	135	Protein_78	protein CopA/IncA	-
JMW07_RS25090	58599..58751	-	153	WP_072258247.1	replication protein A	-
JMW07_RS25095	58832..59854	+	1023	WP_000255944.1	IS21-like element IS100 family transposase	-
JMW07_RS25100	59851..60633	+	783	WP_001300609.1	IS21-like element IS100kyp family helper ATPase IstB	-
JMW07_RS25105	60702..60812	-	111	Protein_82	replication protein	-
JMW07_RS25110	61109..61243	-	135	WP_023144756.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	61288..61348	+	61	NuclAT_2	-	Antitoxin
-	61288..61348	+	61	NuclAT_2	-	Antitoxin
-	61288..61348	+	61	NuclAT_2	-	Antitoxin
-	61288..61348	+	61	NuclAT_2	-	Antitoxin
JMW07_RS25115	61315..61601	-	287	Protein_84	DUF2726 domain-containing protein	-
JMW07_RS25120	62114..62326	-	213	WP_013023861.1	hypothetical protein	-
JMW07_RS25125	62457..63017	-	561	WP_000139341.1	fertility inhibition protein FinO	-
JMW07_RS25130	63072..63818	-	747	WP_000205718.1	conjugal transfer pilus acetylase TraX	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 / sitABCD	iucA / iucB / iucC / iucD / iutA	1..139312	139312

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-44)

Sequences

Toxin

Protein

• Length: 45 a.a.
• Molecular weight: 4896.90 Da
• Isoelectric Point: 7.7209

>T290705 WP_023144756.1 NZ_LR890335:c61243-61109 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Nucleotide

• Length: 135 bp

Antitoxin

Nucleotide

• Length: 61 bp

>AT290705 NZ_LR890335:61288-61348 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A762TWR7

Antitoxin