Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 4623257..4623936 | Replicon | chromosome |
| Accession | NZ_LR890334 | ||
| Organism | Escherichia coli isolate MINF_9A-sc-2280436 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A0A1A1R1 |
| Locus tag | JMW07_RS22175 | Protein ID | WP_000057541.1 |
| Coordinates | 4623257..4623559 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | JMW07_RS22180 | Protein ID | WP_000806442.1 |
| Coordinates | 4623595..4623936 (+) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW07_RS22155 | 4618520..4619740 | - | 1221 | WP_022645286.1 | fosmidomycin MFS transporter | - |
| JMW07_RS22160 | 4619958..4621610 | + | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
| JMW07_RS22165 | 4621647..4622126 | - | 480 | WP_000186638.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| JMW07_RS22170 | 4622330..4623124 | - | 795 | WP_022645287.1 | TraB/GumN family protein | - |
| JMW07_RS22175 | 4623257..4623559 | + | 303 | WP_000057541.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JMW07_RS22180 | 4623595..4623936 | + | 342 | WP_000806442.1 | HigA family addiction module antidote protein | Antitoxin |
| JMW07_RS22185 | 4623994..4626498 | - | 2505 | WP_038431953.1 | copper-exporting P-type ATPase CopA | - |
| JMW07_RS22190 | 4626761..4627693 | + | 933 | WP_022645289.1 | glutaminase A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4623257..4632537 | 9280 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11795.37 Da Isoelectric Point: 10.2638
>T290702 WP_000057541.1 NZ_LR890334:4623257-4623559 [Escherichia coli]
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A1A1R1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2EBY | |
| AlphaFold DB | S1QAY3 |