Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 4399818..4400512 | Replicon | chromosome |
Accession | NZ_LR890334 | ||
Organism | Escherichia coli isolate MINF_9A-sc-2280436 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q0T7Q5 |
Locus tag | JMW07_RS21125 | Protein ID | WP_001263491.1 |
Coordinates | 4400114..4400512 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | L4JHF0 |
Locus tag | JMW07_RS21120 | Protein ID | WP_000554755.1 |
Coordinates | 4399818..4400111 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW07_RS21095 | 4394854..4395114 | - | 261 | WP_000729708.1 | type II toxin-antitoxin system antitoxin DinJ | - |
JMW07_RS21100 | 4395300..4396073 | + | 774 | WP_022645219.1 | C40 family peptidase | - |
JMW07_RS21105 | 4396171..4397883 | - | 1713 | Protein_4119 | flagellar biosynthesis protein FlhA | - |
JMW07_RS21110 | 4397855..4398640 | + | 786 | WP_072224360.1 | putative lateral flagellar export/assembly protein LafU | - |
JMW07_RS21115 | 4398711..4399766 | + | 1056 | WP_022645222.1 | DNA polymerase IV | - |
JMW07_RS21120 | 4399818..4400111 | + | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
JMW07_RS21125 | 4400114..4400512 | + | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
JMW07_RS21130 | 4400522..4400974 | + | 453 | WP_023909048.1 | GNAT family N-acetyltransferase | - |
JMW07_RS21135 | 4401165..4402304 | + | 1140 | WP_022645224.1 | RNA ligase RtcB family protein | - |
JMW07_RS21140 | 4402301..4402915 | + | 615 | WP_022645225.1 | peptide chain release factor H | - |
JMW07_RS21145 | 4402977..4403486 | + | 510 | WP_001361775.1 | hydrolase | - |
JMW07_RS21150 | 4403503..4403784 | - | 282 | WP_022645226.1 | hypothetical protein | - |
JMW07_RS21155 | 4403793..4405250 | - | 1458 | WP_022645227.1 | cytosol nonspecific dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T290700 WP_001263491.1 NZ_LR890334:4400114-4400512 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TPK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829G9H5 |