Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 2650555..2651354 | Replicon | chromosome |
| Accession | NZ_LR890334 | ||
| Organism | Escherichia coli isolate MINF_9A-sc-2280436 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | V0SSH7 |
| Locus tag | JMW07_RS12770 | Protein ID | WP_000347273.1 |
| Coordinates | 2650890..2651354 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | D6JF08 |
| Locus tag | JMW07_RS12765 | Protein ID | WP_001308975.1 |
| Coordinates | 2650555..2650890 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW07_RS12750 | 2646340..2647110 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| JMW07_RS12755 | 2647126..2648460 | - | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
| JMW07_RS12760 | 2648835..2650406 | + | 1572 | WP_023908830.1 | galactarate dehydratase | - |
| JMW07_RS12765 | 2650555..2650890 | + | 336 | WP_001308975.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| JMW07_RS12770 | 2650890..2651354 | + | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| JMW07_RS12775 | 2651409..2652218 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| JMW07_RS12780 | 2652467..2653747 | + | 1281 | WP_023908831.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| JMW07_RS12785 | 2653770..2654243 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| JMW07_RS12790 | 2654254..2655033 | + | 780 | WP_000406214.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
| JMW07_RS12795 | 2655023..2655901 | + | 879 | WP_001298314.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
| JMW07_RS12800 | 2655919..2656353 | + | 435 | WP_000948824.1 | PTS sugar transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T290691 WP_000347273.1 NZ_LR890334:2650890-2651354 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|