Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 410374..410595 | Replicon | chromosome |
| Accession | NZ_LR890334 | ||
| Organism | Escherichia coli isolate MINF_9A-sc-2280436 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A1D7PZ30 |
| Locus tag | JMW07_RS02110 | Protein ID | WP_022645587.1 |
| Coordinates | 410374..410481 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 410529..410595 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW07_RS02085 | 406218..407300 | + | 1083 | WP_022645584.1 | peptide chain release factor 1 | - |
| JMW07_RS02090 | 407300..408133 | + | 834 | WP_022645585.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| JMW07_RS02095 | 408130..408522 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
| JMW07_RS02100 | 408526..409335 | + | 810 | WP_022645586.1 | invasion regulator SirB1 | - |
| JMW07_RS02105 | 409371..410225 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| JMW07_RS02110 | 410374..410481 | - | 108 | WP_022645587.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 410529..410595 | + | 67 | NuclAT_28 | - | Antitoxin |
| - | 410529..410595 | + | 67 | NuclAT_28 | - | Antitoxin |
| - | 410529..410595 | + | 67 | NuclAT_28 | - | Antitoxin |
| - | 410529..410595 | + | 67 | NuclAT_28 | - | Antitoxin |
| - | 410529..410595 | + | 67 | NuclAT_30 | - | Antitoxin |
| - | 410529..410595 | + | 67 | NuclAT_30 | - | Antitoxin |
| - | 410529..410595 | + | 67 | NuclAT_30 | - | Antitoxin |
| - | 410529..410595 | + | 67 | NuclAT_30 | - | Antitoxin |
| - | 410529..410595 | + | 67 | NuclAT_32 | - | Antitoxin |
| - | 410529..410595 | + | 67 | NuclAT_32 | - | Antitoxin |
| - | 410529..410595 | + | 67 | NuclAT_32 | - | Antitoxin |
| - | 410529..410595 | + | 67 | NuclAT_32 | - | Antitoxin |
| - | 410529..410595 | + | 67 | NuclAT_34 | - | Antitoxin |
| - | 410529..410595 | + | 67 | NuclAT_34 | - | Antitoxin |
| - | 410529..410595 | + | 67 | NuclAT_34 | - | Antitoxin |
| - | 410529..410595 | + | 67 | NuclAT_34 | - | Antitoxin |
| - | 410529..410595 | + | 67 | NuclAT_36 | - | Antitoxin |
| - | 410529..410595 | + | 67 | NuclAT_36 | - | Antitoxin |
| - | 410529..410595 | + | 67 | NuclAT_36 | - | Antitoxin |
| - | 410529..410595 | + | 67 | NuclAT_36 | - | Antitoxin |
| - | 410529..410595 | + | 67 | NuclAT_38 | - | Antitoxin |
| - | 410529..410595 | + | 67 | NuclAT_38 | - | Antitoxin |
| - | 410529..410595 | + | 67 | NuclAT_38 | - | Antitoxin |
| - | 410529..410595 | + | 67 | NuclAT_38 | - | Antitoxin |
| - | 410531..410588 | + | 58 | NuclAT_41 | - | - |
| - | 410531..410588 | + | 58 | NuclAT_41 | - | - |
| - | 410531..410588 | + | 58 | NuclAT_41 | - | - |
| - | 410531..410588 | + | 58 | NuclAT_41 | - | - |
| - | 410531..410588 | + | 58 | NuclAT_43 | - | - |
| - | 410531..410588 | + | 58 | NuclAT_43 | - | - |
| - | 410531..410588 | + | 58 | NuclAT_43 | - | - |
| - | 410531..410588 | + | 58 | NuclAT_43 | - | - |
| - | 410531..410588 | + | 58 | NuclAT_45 | - | - |
| - | 410531..410588 | + | 58 | NuclAT_45 | - | - |
| - | 410531..410588 | + | 58 | NuclAT_45 | - | - |
| - | 410531..410588 | + | 58 | NuclAT_45 | - | - |
| - | 410531..410588 | + | 58 | NuclAT_47 | - | - |
| - | 410531..410588 | + | 58 | NuclAT_47 | - | - |
| - | 410531..410588 | + | 58 | NuclAT_47 | - | - |
| - | 410531..410588 | + | 58 | NuclAT_47 | - | - |
| JMW07_RS02115 | 410909..411016 | - | 108 | WP_000170956.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 411069..411130 | + | 62 | NuclAT_40 | - | - |
| - | 411069..411130 | + | 62 | NuclAT_40 | - | - |
| - | 411069..411130 | + | 62 | NuclAT_40 | - | - |
| - | 411069..411130 | + | 62 | NuclAT_40 | - | - |
| - | 411069..411130 | + | 62 | NuclAT_42 | - | - |
| - | 411069..411130 | + | 62 | NuclAT_42 | - | - |
| - | 411069..411130 | + | 62 | NuclAT_42 | - | - |
| - | 411069..411130 | + | 62 | NuclAT_42 | - | - |
| - | 411069..411130 | + | 62 | NuclAT_44 | - | - |
| - | 411069..411130 | + | 62 | NuclAT_44 | - | - |
| - | 411069..411130 | + | 62 | NuclAT_44 | - | - |
| - | 411069..411130 | + | 62 | NuclAT_44 | - | - |
| - | 411069..411130 | + | 62 | NuclAT_46 | - | - |
| - | 411069..411130 | + | 62 | NuclAT_46 | - | - |
| - | 411069..411130 | + | 62 | NuclAT_46 | - | - |
| - | 411069..411130 | + | 62 | NuclAT_46 | - | - |
| - | 411069..411131 | + | 63 | NuclAT_29 | - | - |
| - | 411069..411131 | + | 63 | NuclAT_29 | - | - |
| - | 411069..411131 | + | 63 | NuclAT_29 | - | - |
| - | 411069..411131 | + | 63 | NuclAT_29 | - | - |
| - | 411069..411131 | + | 63 | NuclAT_31 | - | - |
| - | 411069..411131 | + | 63 | NuclAT_31 | - | - |
| - | 411069..411131 | + | 63 | NuclAT_31 | - | - |
| - | 411069..411131 | + | 63 | NuclAT_31 | - | - |
| - | 411069..411131 | + | 63 | NuclAT_33 | - | - |
| - | 411069..411131 | + | 63 | NuclAT_33 | - | - |
| - | 411069..411131 | + | 63 | NuclAT_33 | - | - |
| - | 411069..411131 | + | 63 | NuclAT_33 | - | - |
| - | 411069..411131 | + | 63 | NuclAT_35 | - | - |
| - | 411069..411131 | + | 63 | NuclAT_35 | - | - |
| - | 411069..411131 | + | 63 | NuclAT_35 | - | - |
| - | 411069..411131 | + | 63 | NuclAT_35 | - | - |
| - | 411069..411131 | + | 63 | NuclAT_37 | - | - |
| - | 411069..411131 | + | 63 | NuclAT_37 | - | - |
| - | 411069..411131 | + | 63 | NuclAT_37 | - | - |
| - | 411069..411131 | + | 63 | NuclAT_37 | - | - |
| - | 411069..411131 | + | 63 | NuclAT_39 | - | - |
| - | 411069..411131 | + | 63 | NuclAT_39 | - | - |
| - | 411069..411131 | + | 63 | NuclAT_39 | - | - |
| - | 411069..411131 | + | 63 | NuclAT_39 | - | - |
| JMW07_RS02120 | 411422..412522 | - | 1101 | WP_001301956.1 | sodium-potassium/proton antiporter ChaA | - |
| JMW07_RS02125 | 412792..413022 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| JMW07_RS02130 | 413180..413875 | + | 696 | WP_012311798.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| JMW07_RS02135 | 413919..414272 | - | 354 | WP_001169659.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4029.82 Da Isoelectric Point: 11.4779
>T290682 WP_022645587.1 NZ_LR890334:c410481-410374 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAVIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAVIVSWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT290682 NZ_LR890334:410529-410595 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGGGTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGGGTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|