Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 410374..410595 Replicon chromosome
Accession NZ_LR890334
Organism Escherichia coli isolate MINF_9A-sc-2280436

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1D7PZ30
Locus tag JMW07_RS02110 Protein ID WP_022645587.1
Coordinates 410374..410481 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 410529..410595 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW07_RS02085 406218..407300 + 1083 WP_022645584.1 peptide chain release factor 1 -
JMW07_RS02090 407300..408133 + 834 WP_022645585.1 peptide chain release factor N(5)-glutamine methyltransferase -
JMW07_RS02095 408130..408522 + 393 WP_000200374.1 invasion regulator SirB2 -
JMW07_RS02100 408526..409335 + 810 WP_022645586.1 invasion regulator SirB1 -
JMW07_RS02105 409371..410225 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
JMW07_RS02110 410374..410481 - 108 WP_022645587.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 410529..410595 + 67 NuclAT_28 - Antitoxin
- 410529..410595 + 67 NuclAT_28 - Antitoxin
- 410529..410595 + 67 NuclAT_28 - Antitoxin
- 410529..410595 + 67 NuclAT_28 - Antitoxin
- 410529..410595 + 67 NuclAT_30 - Antitoxin
- 410529..410595 + 67 NuclAT_30 - Antitoxin
- 410529..410595 + 67 NuclAT_30 - Antitoxin
- 410529..410595 + 67 NuclAT_30 - Antitoxin
- 410529..410595 + 67 NuclAT_32 - Antitoxin
- 410529..410595 + 67 NuclAT_32 - Antitoxin
- 410529..410595 + 67 NuclAT_32 - Antitoxin
- 410529..410595 + 67 NuclAT_32 - Antitoxin
- 410529..410595 + 67 NuclAT_34 - Antitoxin
- 410529..410595 + 67 NuclAT_34 - Antitoxin
- 410529..410595 + 67 NuclAT_34 - Antitoxin
- 410529..410595 + 67 NuclAT_34 - Antitoxin
- 410529..410595 + 67 NuclAT_36 - Antitoxin
- 410529..410595 + 67 NuclAT_36 - Antitoxin
- 410529..410595 + 67 NuclAT_36 - Antitoxin
- 410529..410595 + 67 NuclAT_36 - Antitoxin
- 410529..410595 + 67 NuclAT_38 - Antitoxin
- 410529..410595 + 67 NuclAT_38 - Antitoxin
- 410529..410595 + 67 NuclAT_38 - Antitoxin
- 410529..410595 + 67 NuclAT_38 - Antitoxin
- 410531..410588 + 58 NuclAT_41 - -
- 410531..410588 + 58 NuclAT_41 - -
- 410531..410588 + 58 NuclAT_41 - -
- 410531..410588 + 58 NuclAT_41 - -
- 410531..410588 + 58 NuclAT_43 - -
- 410531..410588 + 58 NuclAT_43 - -
- 410531..410588 + 58 NuclAT_43 - -
- 410531..410588 + 58 NuclAT_43 - -
- 410531..410588 + 58 NuclAT_45 - -
- 410531..410588 + 58 NuclAT_45 - -
- 410531..410588 + 58 NuclAT_45 - -
- 410531..410588 + 58 NuclAT_45 - -
- 410531..410588 + 58 NuclAT_47 - -
- 410531..410588 + 58 NuclAT_47 - -
- 410531..410588 + 58 NuclAT_47 - -
- 410531..410588 + 58 NuclAT_47 - -
JMW07_RS02115 410909..411016 - 108 WP_000170956.1 type I toxin-antitoxin system toxin Ldr family protein -
- 411069..411130 + 62 NuclAT_40 - -
- 411069..411130 + 62 NuclAT_40 - -
- 411069..411130 + 62 NuclAT_40 - -
- 411069..411130 + 62 NuclAT_40 - -
- 411069..411130 + 62 NuclAT_42 - -
- 411069..411130 + 62 NuclAT_42 - -
- 411069..411130 + 62 NuclAT_42 - -
- 411069..411130 + 62 NuclAT_42 - -
- 411069..411130 + 62 NuclAT_44 - -
- 411069..411130 + 62 NuclAT_44 - -
- 411069..411130 + 62 NuclAT_44 - -
- 411069..411130 + 62 NuclAT_44 - -
- 411069..411130 + 62 NuclAT_46 - -
- 411069..411130 + 62 NuclAT_46 - -
- 411069..411130 + 62 NuclAT_46 - -
- 411069..411130 + 62 NuclAT_46 - -
- 411069..411131 + 63 NuclAT_29 - -
- 411069..411131 + 63 NuclAT_29 - -
- 411069..411131 + 63 NuclAT_29 - -
- 411069..411131 + 63 NuclAT_29 - -
- 411069..411131 + 63 NuclAT_31 - -
- 411069..411131 + 63 NuclAT_31 - -
- 411069..411131 + 63 NuclAT_31 - -
- 411069..411131 + 63 NuclAT_31 - -
- 411069..411131 + 63 NuclAT_33 - -
- 411069..411131 + 63 NuclAT_33 - -
- 411069..411131 + 63 NuclAT_33 - -
- 411069..411131 + 63 NuclAT_33 - -
- 411069..411131 + 63 NuclAT_35 - -
- 411069..411131 + 63 NuclAT_35 - -
- 411069..411131 + 63 NuclAT_35 - -
- 411069..411131 + 63 NuclAT_35 - -
- 411069..411131 + 63 NuclAT_37 - -
- 411069..411131 + 63 NuclAT_37 - -
- 411069..411131 + 63 NuclAT_37 - -
- 411069..411131 + 63 NuclAT_37 - -
- 411069..411131 + 63 NuclAT_39 - -
- 411069..411131 + 63 NuclAT_39 - -
- 411069..411131 + 63 NuclAT_39 - -
- 411069..411131 + 63 NuclAT_39 - -
JMW07_RS02120 411422..412522 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
JMW07_RS02125 412792..413022 + 231 WP_001146444.1 putative cation transport regulator ChaB -
JMW07_RS02130 413180..413875 + 696 WP_012311798.1 glutathione-specific gamma-glutamylcyclotransferase -
JMW07_RS02135 413919..414272 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4029.82 Da        Isoelectric Point: 11.4779

>T290682 WP_022645587.1 NZ_LR890334:c410481-410374 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp


Antitoxin


Download         Length: 67 bp

>AT290682 NZ_LR890334:410529-410595 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGGGTTCTC

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A1D7PZ30


Antitoxin

Download structure file

References