Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 4285204..4286003 | Replicon | chromosome |
Accession | NZ_LR890326 | ||
Organism | Escherichia coli isolate MINF_1A-sc-2280431 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | JMV91_RS20835 | Protein ID | WP_000347273.1 |
Coordinates | 4285539..4286003 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | V0TI39 |
Locus tag | JMV91_RS20830 | Protein ID | WP_021547164.1 |
Coordinates | 4285204..4285539 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMV91_RS20815 | 4280989..4281759 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
JMV91_RS20820 | 4281775..4283109 | - | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
JMV91_RS20825 | 4283484..4285055 | + | 1572 | WP_001273756.1 | galactarate dehydratase | - |
JMV91_RS20830 | 4285204..4285539 | + | 336 | WP_021547164.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
JMV91_RS20835 | 4285539..4286003 | + | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
JMV91_RS20840 | 4286058..4286867 | - | 810 | WP_000072171.1 | aga operon transcriptional regulator AgaR | - |
JMV91_RS20845 | 4287116..4288396 | + | 1281 | WP_000681958.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
JMV91_RS20850 | 4288419..4288892 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
JMV91_RS20855 | 4288903..4289682 | + | 780 | WP_000406214.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
JMV91_RS20860 | 4289672..4290550 | + | 879 | WP_001295548.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
JMV91_RS20865 | 4290568..4291002 | + | 435 | WP_000948834.1 | PTS sugar transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4263475..4286003 | 22528 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T290666 WP_000347273.1 NZ_LR890326:4285539-4286003 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|