Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 313668..314254 Replicon chromosome
Accession NZ_LR890323
Organism Klebsiella pneumoniae isolate INF348-sc-2280170

Toxin (Protein)


Gene name doc Uniprot ID A0A486RB10
Locus tag JMW45_RS01485 Protein ID WP_004174007.1
Coordinates 313886..314254 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag JMW45_RS01480 Protein ID WP_004174006.1
Coordinates 313668..313889 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMW45_RS01460 309825..310751 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
JMW45_RS01465 310748..312025 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
JMW45_RS01470 312022..312789 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
JMW45_RS01475 312791..313504 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
JMW45_RS01480 313668..313889 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
JMW45_RS01485 313886..314254 + 369 WP_004174007.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
JMW45_RS01490 314527..315843 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
JMW45_RS01495 315950..316837 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
JMW45_RS01500 316834..317679 + 846 WP_004185988.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
JMW45_RS01505 317681..318751 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 310748..319488 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(6-116)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13568.97 Da        Isoelectric Point: 8.6410

>T290632 WP_004174007.1 NZ_LR890323:313886-314254 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDLGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT290632 WP_004174006.1 NZ_LR890323:313668-313889 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A486RB10

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References