Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 100197..100924 | Replicon | plasmid 2 |
| Accession | NZ_LR890318 | ||
| Organism | Klebsiella pneumoniae isolate INF215-sc-2280087 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7W3D9W1 |
| Locus tag | JMX39_RS25955 | Protein ID | WP_011251285.1 |
| Coordinates | 100613..100924 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | JMX39_RS25950 | Protein ID | WP_011251286.1 |
| Coordinates | 100197..100616 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX39_RS25925 | 95789..97156 | + | 1368 | WP_017900870.1 | formimidoylglutamate deiminase | - |
| JMX39_RS25930 | 97681..98216 | + | 536 | Protein_101 | transposase | - |
| JMX39_RS25935 | 98330..98596 | - | 267 | WP_017900868.1 | hypothetical protein | - |
| JMX39_RS25940 | 98700..99668 | + | 969 | WP_074168518.1 | IS5-like element IS903B family transposase | - |
| JMX39_RS25945 | 99714..100127 | - | 414 | WP_017901337.1 | hypothetical protein | - |
| JMX39_RS25950 | 100197..100616 | - | 420 | WP_011251286.1 | helix-turn-helix domain-containing protein | Antitoxin |
| JMX39_RS25955 | 100613..100924 | - | 312 | WP_011251285.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| JMX39_RS25960 | 101129..101587 | - | 459 | Protein_107 | DDE-type integrase/transposase/recombinase | - |
| JMX39_RS25965 | 101680..102057 | + | 378 | WP_004118218.1 | IS66 family insertion sequence hypothetical protein | - |
| JMX39_RS25970 | 102054..102401 | + | 348 | WP_032430752.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| JMX39_RS25975 | 102450..103988 | + | 1539 | WP_017901237.1 | IS66 family transposase | - |
| JMX39_RS25980 | 104028..104141 | + | 114 | Protein_111 | IS5/IS1182 family transposase | - |
| JMX39_RS25985 | 104288..105268 | - | 981 | WP_012569499.1 | IS5-like element ISKpn26 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | pla | 1..226712 | 226712 | |
| - | inside | IScluster/Tn | - | - | 98025..105268 | 7243 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12346.12 Da Isoelectric Point: 9.7248
>T290629 WP_011251285.1 NZ_LR890318:c100924-100613 [Klebsiella pneumoniae]
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
MHVISKEPFEEAAKRYPNDSLAIRALYRLVRETDFSSPAEMLTLIPSLDNFKYRNKWWVLDVGGNNLRVIAYINFVNKRF
YVKHIATHADYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15377.46 Da Isoelectric Point: 4.4420
>AT290629 WP_011251286.1 NZ_LR890318:c100616-100197 [Klebsiella pneumoniae]
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
MITDTAKAIEATKQLVAAVPFLGGSSSESDYREAMELVDYLIENDDENPLIDFLASKIADYEDNSPRFAEFNKAIAEIPV
GVALLRTLIDQHKLSYSDLKDEIGSKSLVSQILSGQRSLTITHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|