Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 328790..329376 | Replicon | chromosome |
Accession | NZ_LR890307 | ||
Organism | Klebsiella pneumoniae isolate INF188-sc-2280054 |
Toxin (Protein)
Gene name | doc | Uniprot ID | - |
Locus tag | JMW12_RS01535 | Protein ID | WP_023285605.1 |
Coordinates | 329008..329376 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | W9B1V1 |
Locus tag | JMW12_RS01530 | Protein ID | WP_004174006.1 |
Coordinates | 328790..329011 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW12_RS01510 | 324947..325873 | + | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
JMW12_RS01515 | 325870..327147 | + | 1278 | WP_004174005.1 | branched chain amino acid ABC transporter permease LivM | - |
JMW12_RS01520 | 327144..327911 | + | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
JMW12_RS01525 | 327913..328626 | + | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
JMW12_RS01530 | 328790..329011 | + | 222 | WP_004174006.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
JMW12_RS01535 | 329008..329376 | + | 369 | WP_023285605.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
JMW12_RS01540 | 329649..330965 | + | 1317 | WP_002920796.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
JMW12_RS01545 | 331072..331959 | + | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
JMW12_RS01550 | 331956..332801 | + | 846 | WP_004145129.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
JMW12_RS01555 | 332803..333873 | + | 1071 | WP_004150074.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 325870..334610 | 8740 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13534.89 Da Isoelectric Point: 8.6410
>T290588 WP_023285605.1 NZ_LR890307:329008-329376 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGITVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGITVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|