Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 3960660..3961459 | Replicon | chromosome |
Accession | NZ_LR890299 | ||
Organism | Escherichia coli isolate MSB1_3B-sc-2280406 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | F0JQM9 |
Locus tag | JM188_RS18845 | Protein ID | WP_000347270.1 |
Coordinates | 3960660..3961124 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | A0A0V9H1L4 |
Locus tag | JM188_RS18850 | Protein ID | WP_001551693.1 |
Coordinates | 3961124..3961459 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JM188_RS18815 | 3955661..3956095 | - | 435 | WP_000948837.1 | PTS sugar transporter subunit IIA | - |
JM188_RS18820 | 3956113..3956991 | - | 879 | WP_001295548.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
JM188_RS18825 | 3956981..3957760 | - | 780 | WP_000406214.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
JM188_RS18830 | 3957771..3958244 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
JM188_RS18835 | 3958267..3959547 | - | 1281 | WP_001551694.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
JM188_RS18840 | 3959796..3960605 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
JM188_RS18845 | 3960660..3961124 | - | 465 | WP_000347270.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
JM188_RS18850 | 3961124..3961459 | - | 336 | WP_001551693.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
JM188_RS18855 | 3961608..3963179 | - | 1572 | WP_001273738.1 | galactarate dehydratase | - |
JM188_RS18860 | 3963554..3964888 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
JM188_RS18865 | 3964904..3965674 | + | 771 | WP_001551692.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17806.22 Da Isoelectric Point: 9.6924
>T290565 WP_000347270.1 NZ_LR890299:c3961124-3960660 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEAH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEAH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9NQ90 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9H1L4 |