Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 3803615..3804212 | Replicon | chromosome |
| Accession | NZ_LR890291 | ||
| Organism | Klebsiella pneumoniae strain KSB1_1B | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | R4YIC5 |
| Locus tag | JMW65_RS18635 | Protein ID | WP_004142563.1 |
| Coordinates | 3803895..3804212 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | R4YH91 |
| Locus tag | JMW65_RS18630 | Protein ID | WP_004142561.1 |
| Coordinates | 3803615..3803902 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMW65_RS18600 | 3799695..3799943 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
| JMW65_RS18605 | 3799961..3800302 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
| JMW65_RS18610 | 3800333..3801448 | - | 1116 | WP_020316605.1 | MBL fold metallo-hydrolase | - |
| JMW65_RS18615 | 3801628..3802209 | + | 582 | WP_004176968.1 | TetR/AcrR family transcriptional regulator | - |
| JMW65_RS18620 | 3802209..3802577 | + | 369 | WP_004142557.1 | MmcQ/YjbR family DNA-binding protein | - |
| JMW65_RS18625 | 3802697..3803350 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| JMW65_RS18630 | 3803615..3803902 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| JMW65_RS18635 | 3803895..3804212 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JMW65_RS18640 | 3804397..3805440 | - | 1044 | WP_004178895.1 | DUF2157 domain-containing protein | - |
| JMW65_RS18645 | 3806107..3806973 | - | 867 | WP_004178894.1 | helix-turn-helix transcriptional regulator | - |
| JMW65_RS18650 | 3807082..3808509 | + | 1428 | WP_004176980.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T290538 WP_004142563.1 NZ_LR890291:c3804212-3803895 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M5MXH8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3DIQ1 |