Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 710678..711453 | Replicon | chromosome |
Accession | NZ_LR890291 | ||
Organism | Klebsiella pneumoniae strain KSB1_1B |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A331A5C5 |
Locus tag | JMW65_RS03560 | Protein ID | WP_019704987.1 |
Coordinates | 710968..711453 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | JMW65_RS03555 | Protein ID | WP_004150912.1 |
Coordinates | 710678..710971 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMW65_RS03535 | 705887..706489 | - | 603 | WP_004174410.1 | short chain dehydrogenase | - |
JMW65_RS03540 | 706587..707498 | + | 912 | WP_004181308.1 | LysR family transcriptional regulator | - |
JMW65_RS03545 | 707499..708647 | - | 1149 | WP_094645045.1 | PLP-dependent aspartate aminotransferase family protein | - |
JMW65_RS03550 | 708658..710034 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
JMW65_RS03555 | 710678..710971 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
JMW65_RS03560 | 710968..711453 | + | 486 | WP_019704987.1 | GNAT family N-acetyltransferase | Toxin |
JMW65_RS03565 | 712151..712744 | + | 594 | WP_004188553.1 | hypothetical protein | - |
JMW65_RS03570 | 712841..713057 | + | 217 | Protein_700 | transposase | - |
JMW65_RS03580 | 714061..714774 | - | 714 | WP_002916694.1 | DUF554 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 712841..712993 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17572.56 Da Isoelectric Point: 8.5111
>T290530 WP_019704987.1 NZ_LR890291:710968-711453 [Klebsiella pneumoniae]
MISAPEPLNAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLNAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A331A5C5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |